DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and TMPRSS3

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_076927.1 Gene:TMPRSS3 / 64699 HGNCID:11877 Length:454 Species:Homo sapiens


Alignment Length:250 Identity:87/250 - (34%)
Similarity:122/250 - (48%) Gaps:34/250 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIP--WLVVVTGTNKYN 99
            ||:||..:.....|:|.||| ..|.|.|||::|...:::||||||.:.::|  |.:.|...:..:
Human   216 RIVGGNMSLLSQWPWQASLQ-FQGYHLCGGSVITPLWIITAAHCVYDLYLPKSWTIQVGLVSLLD 279

  Fly   100 QPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQ-PGDEVILT-GWG 162
            .|...:.::.|..|..|....:.|||||::|..|:.::|..||:.||..... |..:|..| |||
Human   280 NPAPSHLVEKIVYHSKYKPKRLGNDIALMKLAGPLTFNEMIQPVCLPNSEENFPDGKVCWTSGWG 344

  Fly   163 STV--LWGTSPIDLQVLYLQYVPHRECKALLSNDEDC---DV-GHICTFSRL-------GEGACH 214
            :|.  ....||    ||....||      |:|| :.|   || |.|.:.|.|       |..:|.
Human   345 ATEDGAGDASP----VLNHAAVP------LISN-KICNHRDVYGGIISPSMLCAGYLTGGVDSCQ 398

  Fly   215 GDSGGPLVSN----GYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVMSGNSK 264
            ||||||||..    ..|||..::|..|| ...|.|:..|..:.|||...|..:.|
Human   399 GDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWIHEQMERDLK 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 83/239 (35%)
Tryp_SPc 38..258 CDD:238113 84/241 (35%)
TMPRSS3NP_076927.1 LDLa 74..107 CDD:238060
SRCR_2 112..210 CDD:292133
Tryp_SPc 216..444 CDD:214473 83/239 (35%)
Tryp_SPc 217..447 CDD:238113 84/241 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.