DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Tmprss11d

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001028824.2 Gene:Tmprss11d / 64565 RGDID:620654 Length:417 Species:Rattus norvegicus


Alignment Length:233 Identity:81/233 - (34%)
Similarity:116/233 - (49%) Gaps:14/233 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN 99
            ::|||||..||.|..|:|:||| ::..|.|||.:|:..:|||||||..:...|.....|......
  Rat   183 EERIIGGTQAETGDWPWQVSLQ-LNNVHHCGGTLISNLWVLTAAHCFRSYSNPQQWTATFGVSTI 246

  Fly   100 QPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQ--PGDEVILTGWG 162
            .|..|..::||..|..|::....||||:::|..|:.:......:.||.....  |.....:||||
  Rat   247 SPRLRVRVRAILAHAEYNSITRDNDIAVVQLDRPVTFTRNIHRVCLPAATQNIIPDSVAYVTGWG 311

  Fly   163 STVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGE-GACHGDSGGPLVSNG- 225
            |....|.:..:||...::.|....|............|.:|...|.|. .||.||||||||... 
  Rat   312 SLTYGGNTVTNLQQGEVRIVSSEVCNEPAGYGGSVLPGMLCAGVRSGAVDACQGDSGGPLVQEDT 376

  Fly   226 ----YLVGLVNWGWPCATGVPD---VHASVYFYRDWIR 256
                ::||:|:||:.|  |:|:   |:..|..||:|||
  Rat   377 RRLWFVVGIVSWGYQC--GLPNKPGVYTRVTAYRNWIR 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 78/228 (34%)
Tryp_SPc 38..258 CDD:238113 80/230 (35%)
Tmprss11dNP_001028824.2 SEA 48..150 CDD:396113
Tryp_SPc 186..414 CDD:238113 80/230 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.