DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CELA2A

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_254275.1 Gene:CELA2A / 63036 HGNCID:24609 Length:269 Species:Homo sapiens


Alignment Length:261 Identity:77/261 - (29%)
Similarity:119/261 - (45%) Gaps:54/261 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGA---HSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKY 98
            |::||:.|.....|:|:|||..|..   |:|||::|..::|||||||           ::.:..|
Human    28 RVVGGEEARPNSWPWQVSLQYSSNGKWYHTCGGSLIANSWVLTAAHC-----------ISSSRTY 81

  Fly    99 NQPGGRYFL------------KAIHIHCNYDNPEMH--NDIALLELVEPIAWDERTQPIPLPLVP 149
            ....||:.|            ..|.:|.::::.::.  ||||||:|..|::..::.|...||   
Human    82 RVGLGRHNLYVAESGSLAVSVSKIVVHKDWNSNQISKGNDIALLKLANPVSLTDKIQLACLP--- 143

  Fly   150 MQPGDEVI-------LTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSR 207
              |...::       :||||.....|..|..||...|..|.:..|.:............||..  
Human   144 --PAGTILPNNYPCYVTGWGRLQTNGAVPDVLQQGRLLVVDYATCSSSAWWGSSVKTSMICAG-- 204

  Fly   208 LGEG---ACHGDSGGPL---VSNG--YLVGLVNWGWPCATGV---PDVHASVYFYRDWIRNVMSG 261
             |:|   :|:|||||||   .|:|  .:.|:|::|.......   |.|...|..|.|||.:|::.
Human   205 -GDGVISSCNGDSGGPLNCQASDGRWQVHGIVSFGSRLGCNYYHKPSVFTRVSNYIDWINSVIAN 268

  Fly   262 N 262
            |
Human   269 N 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 73/252 (29%)
Tryp_SPc 38..258 CDD:238113 74/254 (29%)
CELA2ANP_254275.1 Tryp_SPc 29..265 CDD:238113 74/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.