DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and c1s

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_002941253.2 Gene:c1s / 613055 XenbaseID:XB-GENE-995410 Length:691 Species:Xenopus tropicalis


Alignment Length:248 Identity:75/248 - (30%)
Similarity:109/248 - (43%) Gaps:27/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLV-----VVT 93
            |..||.||..|:.|..|:.|....|...   ||::|::.:||||||.|.....|.:.     ...
 Frog   433 KSGRIFGGTRAKPGQFPWMIQFTDIELG---GGSLISDRWVLTAAHVVNKKIFPTMFGGVMKFFP 494

  Fly    94 GTNKYNQPGGRYFLKAIHIHCNYDNPE-------MHNDIALLELVEPIAWDERTQPIPLPLVPMQ 151
            .||..:|. .|...|.|.||..|.:.|       ..|||||::|.:.:.......||.||...:.
 Frog   495 NTNLQSQE-KRLQAKKIIIHPLYQDNEDTEGQSNFDNDIALVQLTKKVKLGSCISPICLPRRGLA 558

  Fly   152 P--GDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACH 214
            |  .:...:.|||.|.. ..|.::||...:......:||.............:|..|.:|:.:|:
 Frog   559 PVVNEVATIAGWGKTEK-RESAVNLQFASISLSSMDKCKKATGGKGYFTPNMLCAGSDVGKDSCN 622

  Fly   215 GDSGGPLV-------SNGYLVGLVNWGWPCATGVPDVHASVYFYRDWIRNVMS 260
            |||||||:       |..|:.|:|:|| |...|...::..|..|.|||...::
 Frog   623 GDSGGPLMFTDPQDSSKMYMAGIVSWG-PRDCGTYGLYTKVDNYLDWIEETIA 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/238 (30%)
Tryp_SPc 38..258 CDD:238113 73/240 (30%)
c1sXP_002941253.2 CUB 21..131 CDD:238001
FXa_inhibition 145..173 CDD:405372
CUB 177..288 CDD:238001
PHA02927 301..>436 CDD:222943 1/2 (50%)
Tryp_SPc 436..669 CDD:214473 72/238 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.