DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG17242

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:262 Identity:76/262 - (29%)
Similarity:123/262 - (46%) Gaps:35/262 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINE 71
            ::|.|:..||||..|.           .|.:.||.:.     ||:|.|:| |:..|.|||.|.:|
  Fly     1 MLLKGILLLVSIAQIA-----------ADFKSIGIEQ-----APWQASVQ-INDKHHCGGVIYSE 48

  Fly    72 TFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAW 136
            ..:||.|.||..|.:.::.|..|:.:.|..|....::.:.:......|   :|:|:|:|..|:..
  Fly    49 DIILTIAECVRKARLEFISVRVGSAQENAGGTVLKVEKMRLQVLGLRP---SDVAILQLRSPLYL 110

  Fly   137 DERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSP-----IDLQVL-YLQYVPHRECKALLSNDE 195
            |...:.|||..:|:.||....::|||.......|.     :|:::. .|....:...|..|.:  
  Fly   111 DGGIRAIPLATIPLVPGTNASVSGWGQLSAMNPSSEVLLRVDVKIQDQLMCATNLALKGRLMS-- 173

  Fly   196 DCDVGHICTFSRLGE--GACHGDSGGPLVSNGYLVGLVNWGWPC-ATGVPDVHASVYFYRDWIRN 257
               ||.||. :..||  .||.|..|||||:|..|.|:::|...| ......|:|::..::.||.:
  Fly   174 ---VGEICA-APAGEIPYACQGFVGGPLVANNRLYGILSWQSACDVLNKSSVYANIAMFKVWIES 234

  Fly   258 VM 259
            .:
  Fly   235 TV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 66/226 (29%)
Tryp_SPc 38..258 CDD:238113 68/228 (30%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 66/225 (29%)
Tryp_SPc 24..232 CDD:214473 64/222 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.