DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG17234

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:240 Identity:80/240 - (33%)
Similarity:114/240 - (47%) Gaps:29/240 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCV---------ENAFIPWLV 90
            :||||||:.......|:|:||| ..|.|.|||:|.:|..::|||||.         :..:    .
  Fly    24 EQRIIGGEPIGIEQVPWQVSLQ-YFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGY----Q 83

  Fly    91 VVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDE 155
            |..|:...:..|....:.|:.||..|......||||::.|..|:.:..:.|||||......|...
  Fly    84 VRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSI 148

  Fly   156 VILTGWGSTVLWGTS----PIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGD 216
            .:::|||.:.:...|    |..||.|.|.......|:..       |...:|. ...|..|||||
  Fly   149 ALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRLF-------DPSLLCA-GTYGRTACHGD 205

  Fly   217 SGGPLVSNGYLVGLVNWGWP-CATGVPDVHASVYFYRDWIRNVMS 260
            ||||||.|..|||:|:||.. |.:..  ...||.::|:||.|.::
  Fly   206 SGGPLVVNKQLVGVVSWGRKGCVSSA--FFVSVPYFREWILNAIA 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 76/231 (33%)
Tryp_SPc 38..258 CDD:238113 77/233 (33%)
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 76/231 (33%)
Tryp_SPc 27..243 CDD:238113 75/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.