DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG17239

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster


Alignment Length:222 Identity:71/222 - (31%)
Similarity:109/222 - (49%) Gaps:8/222 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQ 100
            :||:||........|:|.|:..:...| ||.||.:|..|:|||||:.:....:|.|..|:: :..
  Fly    22 ERIVGGDLITILSVPWQASILRLGRFH-CGAAIYSEDIVITAAHCLTDRETEFLSVRVGSS-FTF 84

  Fly   101 PGGRYF-LKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGST 164
            .||:.. :.::.:|..||. ...||||::.|...:........|||...|...|....::|||:.
  Fly    85 FGGQVVRVSSVLLHEEYDQ-SWSNDIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATVSGWGAI 148

  Fly   165 VLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVG 229
            ......|:.:....:..|...:|:.........|:  ||. :..|:.||.|||||||||...|||
  Fly   149 GFKKNYPMSILSASVDIVDQDQCRRSYGRKITKDM--ICA-AAPGKDACSGDSGGPLVSGNKLVG 210

  Fly   230 LVNWGWPCA-TGVPDVHASVYFYRDWI 255
            :|::|..|| ...|.|:|:|...:.||
  Fly   211 IVSFGKECAHPEYPGVYANVAELKPWI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 69/219 (32%)
Tryp_SPc 38..258 CDD:238113 70/220 (32%)
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 69/219 (32%)
Tryp_SPc 24..237 CDD:238113 68/218 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.