DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG18754

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:317 Identity:67/317 - (21%)
Similarity:100/317 - (31%) Gaps:138/317 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 QAAEDGFAPYQISLQG-------------------ISGAHSCG------------GAIINE---- 71
            ||.:|.||..|..|..                   :....:||            .|.:||    
  Fly    56 QAEKDVFAHRQCGLDPNGHELLHMVYVCCPELGDVLPNKQTCGQTTPVFRDRGAENAELNEYPWM 120

  Fly    72 ------------TFVLTAAHCVENAFI--------------------------PWLVVVTGTNKY 98
                        .:||||||||...::                          |.|.|..|....
  Fly   121 VLLLYENRLSLIRYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTV 185

  Fly    99 NQ----PGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPI-------PLPLVPMQP 152
            :|    .||.|                .||||||.|..|:.:.::.|||       ||..:.:| 
  Fly   186 HQGFTSSGGTY----------------RNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLNLQ- 233

  Fly   153 GDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDC--------DVGHICTFSRLG 209
                 ::||..|.       ..|.|....|..|       |..||        ....:|...:..
  Fly   234 -----ISGWDPTK-------SSQTLITSTVKER-------NPADCLNRYPSFRSASQVCAGGQRK 279

  Fly   210 EGACHGDSGGP---LVSNG-----YLVGLVNWG--WPCATGVPDVHASVYFYRDWIR 256
            ...|.|.||.|   ::.:|     :|.|:.::|  :..:.|:|.|:..:..:.:||:
  Fly   280 GDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIK 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 65/314 (21%)
Tryp_SPc 38..258 CDD:238113 67/317 (21%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855 7/27 (26%)
Tryp_SPc 108..338 CDD:238113 58/265 (22%)
Tryp_SPc 108..335 CDD:214473 56/262 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.