DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG34436

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster


Alignment Length:233 Identity:57/233 - (24%)
Similarity:90/233 - (38%) Gaps:66/233 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 SCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQ------PGGRYFLKAIHIHCNYDNPEM 121
            :|.||:|::.||:|:|.||.|.  ...:|..|.....|      ....|.:::.:||..|:....
  Fly    53 TCSGALIHKYFVITSASCVFNQ--ERAIVRLGQLSIKQEHIVSYSSDDYHVQSAYIHRFYEKSNF 115

  Fly   122 HNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLW-GTSPIDLQVLYLQYVPHR 185
            .:|||||||...:.:....:||                     .|| ..|.||.| ::.:|...|
  Fly   116 EHDIALLELQNDVLYKAHIRPI---------------------CLWLDKSDIDTQ-MFKRYETFR 158

  Fly   186 ---ECKALLSNDEDCDVGHI----C--TFSRLGEGA--CHG--------DSGGPLVSN------- 224
               :.|.:|...:...:.||    |  .|....:.:  |.|        ::|.||...       
  Fly   159 WGIDEKYILPAAKTSKIKHISQVKCENAFKLYPQNSHICAGYKNKSKCVETGSPLFKKIRYYTKI 223

  Fly   225 GY-LVGLVNWG--WPCATGVPDVHASVYFYRDWIRNVM 259
            .| |.|:.::|  ..|      ::..|..|.|||..|:
  Fly   224 RYTLFGIQSYGESRTC------LYTDVTKYIDWIMGVI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 54/227 (24%)
Tryp_SPc 38..258 CDD:238113 56/230 (24%)
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 55/228 (24%)
Tryp_SPc 40..251 CDD:214473 54/227 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.