DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG34171

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:223 Identity:59/223 - (26%)
Similarity:95/223 - (42%) Gaps:36/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 HSCGGAIINETFVLTAAHCV--ENAFI---PWLVVVTGTNKYNQPGGRYFLKAIH---IHCNYDN 118
            |.|.|.|:....|||:|||:  :|..:   ..:||....:.:..|....|:..||   || .|.:
  Fly    55 HFCTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIH-PYYH 118

  Fly   119 PEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQ-------- 175
            ...|||||:::|...:..|..      .|.|:..|:..:..|.....:.|...:..|        
  Fly   119 RNQHNDIAIIKLKRYVKLDGH------HLAPVVLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHSM 177

  Fly   176 -VLYLQYVPHREC----KALLS---NDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVN 232
             ::.::..|..||    |:|::   .:||.    ||..| ..:..|..|.||||..:|.|.|:..
  Fly   178 LLVNVELRPFDECLKVKKSLMAARPENEDL----ICVKS-TEKQMCTTDFGGPLFCDGQLYGIAL 237

  Fly   233 WGWPCATGVPDVHASVYFYRDWIRNVMS 260
            ....|::..|...:.|.||..|:..::|
  Fly   238 GSINCSSPDPVFFSDVSFYNSWVTKIIS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 57/216 (26%)
Tryp_SPc 38..258 CDD:238113 58/219 (26%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 57/216 (26%)
Tryp_SPc 38..263 CDD:304450 58/219 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.