DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG34171

DIOPT Version :10

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:37 Identity:9/37 - (24%)
Similarity:16/37 - (43%) Gaps:10/37 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LTAVATITLNLCQEFCAGVNGGESYENCSPWLSYATA 49
            :|.:|||:.:.          .||..:..|:|..:.|
  Fly   235 VTKIATISKSY----------NESGNDSPPYLQLSCA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 38..258 CDD:238113 3/12 (25%)
CG34171NP_001097175.2 Tryp_SPc 38..263 CDD:473915 9/37 (24%)

Return to query results.
Submit another query.