DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and tmprss5

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_009289870.1 Gene:tmprss5 / 569688 ZFINID:ZDB-GENE-131121-184 Length:551 Species:Danio rerio


Alignment Length:288 Identity:88/288 - (30%)
Similarity:138/288 - (47%) Gaps:49/288 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GLVSITA---------IRIKGNSTDGRFY-----------KDQRIIGGQAAEDGFAPYQISLQGI 58
            |.|.||:         .|.:|:.:.|:..           |..|||||..|..|..|:|:||. .
Zfish   268 GFVQITSEYQSNLESLWRFRGSCSTGKVIALKCFECGTRAKLPRIIGGVEAALGRWPWQVSLY-Y 331

  Fly    59 SGAHSCGGAIINETFVLTAAHCVENAFIP----WLV----VVTGTNKYNQPGGRYFLKAIHIHCN 115
            :..|.|||:||...:::||||||.|..:|    |:|    :.:...|..|..| :.::.|..:.|
Zfish   332 NNRHICGGSIITNQWIVTAAHCVHNYRLPQVPSWVVYAGIITSNLAKLAQYQG-FAVERIIYNKN 395

  Fly   116 YDNPEMHNDIALLELVEPIAWDERTQPIPLPLV--PMQPGDEVILTGWGSTVLWGTSPIDL---Q 175
            |::....|||||::|..|:.:.:..:|:.||..  .:..|.:..::|||.     |.|.|:   :
Zfish   396 YNHRTHDNDIALVKLKTPLNFSDTIRPVCLPQYDHDLPGGTQCWISGWGY-----TQPDDVLIPE 455

  Fly   176 VLYLQYVP---HRECKALLSNDEDCDVGHICT-FSRLGEGACHGDSGGPLVSNG----YLVGLVN 232
            ||....||   .::|.:....:.:.....:|. :|.....||.||||||||...    .|||:|:
Zfish   456 VLKEAPVPLISTKKCNSSCMYNGEITSRMLCAGYSEGKVDACQGDSGGPLVCQDENVWRLVGVVS 520

  Fly   233 WGWPCA-TGVPDVHASVYFYRDWIRNVM 259
            ||..|| ...|.|::.|..:..||.:::
Zfish   521 WGTGCAEPNHPGVYSKVAEFLGWIYDII 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 78/239 (33%)
Tryp_SPc 38..258 CDD:238113 79/241 (33%)
tmprss5XP_009289870.1 SRCR_2 211..306 CDD:292133 7/37 (19%)
Tryp_SPc 311..544 CDD:214473 78/239 (33%)
Tryp_SPc 312..547 CDD:238113 79/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.