DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP011913

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_001689277.1 Gene:AgaP_AGAP011913 / 5667996 VectorBaseID:AGAP011913 Length:399 Species:Anopheles gambiae


Alignment Length:286 Identity:76/286 - (26%)
Similarity:112/286 - (39%) Gaps:34/286 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLLILLGLSGL------VSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAH- 62
            :::.|||.:..      ..|||:::   :.|...:|...|:.|........|....|...|.|. 
Mosquito   123 LVVALLGSTSTSGGRFRCQITALKL---ACDCGRHKTPTIVNGFPTLTNEYPMMAGLVDNSLAKV 184

  Fly    63 SCGGAIINETFVLTAAHCVENAFIPWLVVVTG-----TNKYNQPGGRYFLKAIHIHCNYDNPEMH 122
            .||..|:.:..|||||||:.:..:....|:.|     |.........|.:.....|.:|:.....
Mosquito   185 FCGSTIVTDRHVLTAAHCLLDRTVTGTSVLVGDQDISTGSDTPYSSLYRISTFTQHPSYNPTSKT 249

  Fly   123 NDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVI---LTGWGSTVLWGTSPIDLQVLYLQYVPH 184
            |||||::....|.::.....:.||........|.:   ..|||:......|..:|....|..|..
Mosquito   250 NDIALVQTFNTIVFNPGVGRVCLPFFFSTSSFENVRLSALGWGAIDFGAPSSNELLQTTLTVVSS 314

  Fly   185 RECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNG------YLVGLVNWGWPCATGVPD 243
            ..|...||  .......:|||: .|...|..||||||....      |.:|:|.:|..||:..|.
Mosquito   315 TSCGTQLS--RTILASQMCTFA-AGNDTCQNDSGGPLYYTDPNSQLVYSIGVVGFGVACASSFPS 376

  Fly   244 VHASVYFYRDWIRNVMSGNSKCTGFS 269
            |:..|..|.|||       |..||::
Mosquito   377 VNTRVTSYLDWI-------SSTTGYT 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 63/232 (27%)
Tryp_SPc 38..258 CDD:238113 65/234 (28%)
AgaP_AGAP011913XP_001689277.1 CUB 35..144 CDD:238001 4/20 (20%)
Tryp_SPc 159..391 CDD:238113 66/241 (27%)
Tryp_SPc 159..388 CDD:214473 63/231 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.