DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP011919

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_001689275.1 Gene:AgaP_AGAP011919 / 5667955 VectorBaseID:AGAP011919 Length:262 Species:Anopheles gambiae


Alignment Length:247 Identity:80/247 - (32%)
Similarity:128/247 - (51%) Gaps:6/247 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVSITAIRIKGNS-TDGRFYKD--QRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLT 76
            :|...|:.:.|.| |....|:.  .||:||..|.||..|||.|.:.:.|.|.||||::|:.:|:|
Mosquito    10 IVCFLAVAVSGESATSDPLYQQWKGRIVGGTYARDGDFPYQASFRTLDGMHICGGAVLNQQWVIT 74

  Fly    77 AAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQ 141
            ||.|:.........||.|..:.:|.|....|:.|.||.|:.:..:.||:|:..:.:.:...:..|
Mosquito    75 AASCLFGRSTADTRVVVGAYRLSQGGFNLGLRRIVIHPNFASATLANDVAVARVAQQMVLSDAVQ 139

  Fly   142 PIPLPLVPMQPGDEVILTGWGSTVLWGTS-PIDLQVLYLQYVPHRECKALLSNDEDCDV--GHIC 203
            .:.|....:......:::|||.|...... |.:||.:.:..:...||:|..:...|..:  ..:|
Mosquito   140 GVQLGSYNINVAYGALVSGWGRTEFSNPQFPDNLQYIAVNVISQLECRARFAAPYDARIYDSTMC 204

  Fly   204 TFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCATGVPDVHASVYFYRDWI 255
            :.|.:|:|.|.||:|.||:....|.|:|:||.||..|.|||:|.:..:|.||
Mosquito   205 SSSPVGQGTCLGDAGSPLIHGAELHGIVSWGIPCGEGYPDVYARISSHRGWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/220 (33%)
Tryp_SPc 38..258 CDD:238113 73/221 (33%)
AgaP_AGAP011919XP_001689275.1 Tryp_SPc 35..256 CDD:214473 72/220 (33%)
Tryp_SPc 36..256 CDD:238113 71/219 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D104368at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.