DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP010618

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_001688265.1 Gene:AgaP_AGAP010618 / 5667797 VectorBaseID:AGAP010618 Length:252 Species:Anopheles gambiae


Alignment Length:257 Identity:61/257 - (23%)
Similarity:105/257 - (40%) Gaps:53/257 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGL---SGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQ-ISLQGISGA 61
            |...:.|::.||   |.:::|.....|.........:..||:.|...:  .:.|: :::..|...
Mosquito     1 MKQGICLVVFGLFACSTILAIEDFEAKATLRSVEAVQSGRIVNGTRKD--ISKYKFMAIVYIQKE 63

  Fly    62 HSCGGAIINETFVLTAAHCV----------ENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCN- 115
            :.|..:|::.:..|||||||          :...:..:|.:|.:..|.:.|.        |..| 
Mosquito    64 YVCSASIVSGSHALTAAHCVTIRGGSSDIFKGGTLFQVVKITVSPNYMRTGS--------IARNV 120

  Fly   116 YDNPEMHNDIALLEL----------VEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTS 170
            ||     ||:|:|.:          :.||::....:   ||     .|......|||.|..  ..
Mosquito   121 YD-----NDVAVLTVATNAFVGKPNIAPISFATSAE---LP-----SGTRCYALGWGRTNF--DE 170

  Fly   171 PIDLQVLYLQY--VPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGL 230
            .:..::||.::  |...:|:...|...:.....||..::..| .|.||||||||.:..|.|:
Mosquito   171 NLSTKLLYAEFKLVLTADCRKAYSGKANITPNVICGKAKNSE-VCEGDSGGPLVCDNKLTGI 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 54/218 (25%)
Tryp_SPc 38..258 CDD:238113 53/217 (24%)
AgaP_AGAP010618XP_001688265.1 Tryp_SPc 40..250 CDD:214473 54/218 (25%)
Tryp_SPc 41..252 CDD:238113 53/217 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.