DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP001249

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_001689375.2 Gene:AgaP_AGAP001249 / 5667667 VectorBaseID:AGAP001249 Length:267 Species:Anopheles gambiae


Alignment Length:292 Identity:76/292 - (26%)
Similarity:130/292 - (44%) Gaps:46/292 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSI-------TAIRI-KGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQG 57
            |.|.:||.|.....|..:       ..:|: .|.|.:    .:.||:||........|||:||:.
Mosquito     1 MKAFILLSLFVAGALAGVEESIWLSKQVRLDAGTSAE----YNGRIVGGSTVPISQFPYQLSLRQ 61

  Fly    58 ISGAHSCGGAIINETFVLTAAHCVENAF-IPWLVVVT---GTNKYNQPGGRYFLKAIHI--HCNY 116
             :|.|.||.::|:..:.|:||||   .| :|....::   |::  ::.||....:|..|  |..|
Mosquito    62 -NGNHICGASVISSNWALSAAHC---TFPMPSAASISFRGGSD--SRTGGGVIFQAAQIINHPQY 120

  Fly   117 DNPEMHNDIALLELVEPIAWDERTQPIPLPLV----PMQPGDEVILTGWGSTVLWGTSPIDLQVL 177
            ::..::||:.::.:.....   .....|:.||    ....|...:::|||.|...|:.|::|..:
Mosquito   121 NSNNLNNDVCVIRITTSFV---GANIAPIRLVASGTSFAAGTNSVVSGWGLTSPGGSLPVNLHAV 182

  Fly   178 YLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWG-WPCATGV 241
            .:..|....|.:...... .....:|...: |..:|:||||||||:.|...|:|:|| ..|...:
Mosquito   183 NIPVVAQATCSSQWGTGR-ITAAMVCAGVQ-GRDSCNGDSGGPLVTGGAQFGVVSWGAVQCGGPL 245

  Fly   242 PDVHASVYFYRDWIRNVMSGNSKCTGFSSNQS 273
            |.|:|::            ||:....|.|..:
Mosquito   246 PGVYANI------------GNAGIRSFISQNT 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 63/228 (28%)
Tryp_SPc 38..258 CDD:238113 62/230 (27%)
AgaP_AGAP001249XP_001689375.2 Tryp_SPc 41..254 CDD:214473 63/235 (27%)
Tryp_SPc 42..264 CDD:238113 66/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.