DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP001247

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_001689376.2 Gene:AgaP_AGAP001247 / 5667666 VectorBaseID:AGAP001247 Length:253 Species:Anopheles gambiae


Alignment Length:250 Identity:79/250 - (31%)
Similarity:120/250 - (48%) Gaps:25/250 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAF 85
            :|:.|           ||.||.......||:|:||:... :|.||.::::.:..:|||||:....
Mosquito    11 VRVTG-----------RIFGGMETNIKDAPHQLSLRRFD-SHICGASVVDASLAITAAHCLTPKP 63

  Fly    86 IPWLVVVTG--TNKYNQPGGRYFLKAIH--IHCNYDNPEMHNDIALLELVEPIAWDERTQPIPL- 145
            .|..:.:.|  ||:.:...|..| .||.  ||..|::...|||:||:.:.......|...|||| 
Mosquito    64 PPEFITLMGGSTNRTDYDVGVIF-NAIELIIHPGYNSNTFHNDVALVRIEGTFGGYENVAPIPLR 127

  Fly   146 -PLVPMQPGDEVILT--GWGSTVLWGTS-PIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFS 206
             ..:.....:.|..|  |||.|.:.|.. |..|:::.:..||:.||:... |........||. .
Mosquito   128 TRTIFTSSSNPVYCTVSGWGLTNMNGDGLPEILRIVRIPLVPYTECRRKW-NPFPITSSMICA-G 190

  Fly   207 RLGEGACHGDSGGPLVSNGYLVGLVNWGW-PCATGVPDVHASVYFYRDWIRNVMS 260
            .|.:.||:||||||||.||.|.|:|:||. .|.:..|.::.|:.....::...||
Mosquito   191 ELRKDACNGDSGGPLVCNGQLYGIVSWGSNQCGSSYPGIYTSIPAVLSFLSEYMS 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/227 (33%)
Tryp_SPc 38..258 CDD:238113 74/229 (32%)
AgaP_AGAP001247XP_001689376.2 Tryp_SPc 16..238 CDD:214473 75/225 (33%)
Tryp_SPc 17..242 CDD:238113 74/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.