DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP001250

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_001689374.2 Gene:AgaP_AGAP001250 / 5667664 VectorBaseID:AGAP001250 Length:279 Species:Anopheles gambiae


Alignment Length:240 Identity:74/240 - (30%)
Similarity:116/240 - (48%) Gaps:37/240 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWL 89
            |.|.||   |..||:||:.|.....|||:||:. ||.|:||.::|:..:.|:||||...  ||.:
Mosquito    44 GASHDG---KSARIVGGRDAPIENFPYQLSLRR-SGVHACGASVISLRWALSAAHCTYP--IPQM 102

  Fly    90 VVVT---GTNKYNQPGGRYFLKAIHI--HCNYDNPEMHNDIALL----ELVEPIAWDERTQPIPL 145
            ..::   |::  |:..|...:....|  |..:....:..|:.:|    |:|....       :|:
Mosquito   103 NEMSLRAGSS--NRLAGGTIIPITQIINHPLFSEYTIEYDVCVLQTSTEMVGQFI-------VPV 158

  Fly   146 PLVP----MQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSND---EDCDVGHIC 203
            .|.|    ..||.....||||...:.|:.|:.||.:.|..:...:|:....::   |:.    :|
Mosquito   159 VLPPATSGFAPGTMANATGWGLLNVPGSLPVQLQYVALPLISLDQCRNSWPSEWITEEM----LC 219

  Fly   204 TFSRLGEGACHGDSGGPLVSNGYLVGLVNWG-WPCATGVPDVHAS 247
            . .:.|...|.||||||||.|||.:|:.:|| ..|:..:|.|.|:
Mosquito   220 A-GQPGRDTCGGDSGGPLVINGYQMGIASWGVSECSGNLPSVFAN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 69/228 (30%)
Tryp_SPc 38..258 CDD:238113 68/227 (30%)
AgaP_AGAP001250XP_001689374.2 Tryp_SPc 53..273 CDD:214473 69/228 (30%)
Tryp_SPc 54..273 CDD:238113 68/227 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.