DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP005686

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_001688706.1 Gene:AgaP_AGAP005686 / 5667393 VectorBaseID:AGAP005686 Length:297 Species:Anopheles gambiae


Alignment Length:256 Identity:80/256 - (31%)
Similarity:116/256 - (45%) Gaps:43/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 STDGRFYKDQRIIGGQAAEDGFAPYQISLQG--ISGAHSCGGAIINETFVLTAAHCVE---NAFI 86
            |||       ||..||.|..|..|||::|..  ..|...||.:::...|:||||||:.   ||..
Mosquito    53 STD-------RITNGQEALPGQFPYQVALLSDFPEGTALCGASVLTRNFLLTAAHCISGTGNALS 110

  Fly    87 PWLVVVTGTN-----KYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLP 146
            ...:.:.|..     :.:|...|:....|..|..||...:.||:||:.|...|.:..|.|||.||
Mosquito   111 SGGIAIMGAQNRMIVELSQQRIRFSTSGIRRHPGYDATSLRNDVALVLLNSRITFTSRVQPIRLP 175

  Fly   147 L---VPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVG-------- 200
            .   .....|....::|:|.|    |.........|::..:    .:|:|.| |...        
Mosquito   176 ARTDTRQFGGFTGTVSGFGRT----TDSSQATSATLRFTSN----PVLTNAE-CITSWGFGLAQS 231

  Fly   201 -HICTFSRLGEGACHGDSGGPLV--SNGYL-VGLVNW--GWPCATGVPDVHASVYFYRDWI 255
             ::|..:..|..||:|||||||.  |||.| :|:|::  ...||:|.|.|:|.|.::..||
Mosquito   232 QNVCLKASGGRSACNGDSGGPLTVDSNGVLQIGVVSFVSAAGCASGRPSVYARVTYFLPWI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/244 (31%)
Tryp_SPc 38..258 CDD:238113 76/245 (31%)
AgaP_AGAP005686XP_001688706.1 Tryp_SPc 56..292 CDD:214473 75/244 (31%)
Tryp_SPc 57..295 CDD:238113 76/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.