DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP005690

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_001688708.1 Gene:AgaP_AGAP005690 / 5667342 VectorBaseID:AGAP005690 Length:300 Species:Anopheles gambiae


Alignment Length:259 Identity:81/259 - (31%)
Similarity:122/259 - (47%) Gaps:51/259 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YKDQ----RIIGGQAAEDGFAPYQISL--QGISGAHSCGGAIINETFVLTAAHCV---ENAFIPW 88
            |:::    ||..||.|..|..|:||:|  :..||...|||:::...|:|||||||   .:.....
Mosquito    47 YREKLPSHRITNGQEATPGQFPFQIALISEFASGNGLCGGSVLTRNFILTAAHCVVSGASTLASG 111

  Fly    89 LVVVTGTNKYN-----QPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLP-- 146
            .|.:.|.:..|     |...|:....|..|.:|.:..:.||||.:.|..|:.:..|.|||.||  
Mosquito   112 GVAIMGAHNRNIQESTQQRIRFATSGIRRHPSYSSSTLRNDIATVRLNSPMTFTTRIQPIRLPGR 176

  Fly   147 -LVPMQPGDEVILTGWGST----------VLWGTSPIDLQVLYLQYVPHRECKA----LLSNDED 196
             ......|....::|:|.|          |.:.|:|:         :.:.:|.|    .:.|.  
Mosquito   177 SDTRQFGGFTGTVSGFGRTSDASSATSAVVRFTTNPV---------MTNTDCIARWGSTVVNQ-- 230

  Fly   197 CDVGHICTFSRLGEGACHGDSGGPLV--SNGYL-VGLVNWGW--PCATGVPDVHASVYFYRDWI 255
                |:|.....|..:|:|||||||.  |.|.: :|:|::|.  .||.|:|.|:|.|.|:.|||
Mosquito   231 ----HVCLSGAGGRSSCNGDSGGPLTVQSGGTMQIGVVSFGSVNGCAIGMPSVYARVTFFLDWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 78/249 (31%)
Tryp_SPc 38..258 CDD:238113 79/250 (32%)
AgaP_AGAP005690XP_001688708.1 Tryp_SPc 55..290 CDD:214473 78/249 (31%)
Tryp_SPc 56..290 CDD:238113 77/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.