DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP005705

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_001688714.1 Gene:AgaP_AGAP005705 / 5667318 VectorBaseID:AGAP005705 Length:311 Species:Anopheles gambiae


Alignment Length:325 Identity:74/325 - (22%)
Similarity:123/325 - (37%) Gaps:82/325 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRF----------------------------YKDQ- 36
            :|||.   ||||: :||:.|. :.|..|..|.                            |.:: 
Mosquito     4 LSAVA---LLGLT-IVSVVAC-VSGEGTITRLEDINWAEVRPVQESPLFKAKRAASFVERYLERV 63

  Fly    37 --------RIIGGQAAEDGFAPYQISLQGI-----SGAHSCGGAIINETFVLTAAHCVENAFIPW 88
                    ||..|........||   :.|:     .|.:.|||.:::.|.|||:|.|||..  ..
Mosquito    64 APAPERTGRINNGVIVGPTDVPY---IVGVLVSVEQGTYFCGGVLVSRTHVLTSATCVEGQ--TS 123

  Fly    89 LVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPG 153
            :.|:.|.:...:......:..:.:|.::.:....||:|:|.|.....::::.|...||. ..|.|
Mosquito   124 ITVLLGASDITRAQDFVVVSHVRVHPDFSSFFQANDLAILTLSRMPRFNDQIQLARLPR-RSQVG 187

  Fly   154 DE-----VILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDV--------GHICTF 205
            :.     ..::|||.|.......:.:|.|       |..::.:.::..|.:        .::||.
Mosquito   188 ESFTNAWTTISGWGETASNTGEALPMQQL-------RSVRSQVISNFSCTISFPLYLRSSNVCTS 245

  Fly   206 SRLGEGACHGDSGGPLV-------SNGYLVGLVNWGWPCATGVPDVHASVYFYRDWIRNVMSGNS 263
            |. |...|.||.|||:.       |....:....:...|....|.||..|..|.:|| .:.:|.|
Mosquito   246 SD-GGAPCVGDEGGPVTIVEEDGQSTVIAIHSYTYSRGCTRSWPAVHTRVTDYLNWI-EIYTGAS 308

  Fly   264  263
            Mosquito   309  308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 56/242 (23%)
Tryp_SPc 38..258 CDD:238113 57/244 (23%)
AgaP_AGAP005705XP_001688714.1 Tryp_SPc 72..301 CDD:214473 56/242 (23%)
Tryp_SPc 73..302 CDD:238113 57/243 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.