DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP005703

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_001688713.1 Gene:AgaP_AGAP005703 / 5667317 VectorBaseID:AGAP005703 Length:289 Species:Anopheles gambiae


Alignment Length:290 Identity:87/290 - (30%)
Similarity:130/290 - (44%) Gaps:58/290 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LILLGLSGLVSI-TAIRIKGNSTD------GRFY-------KDQRIIGGQAAEDGFAPYQISL-- 55
            |:||..|.|:.: |:.|...::.|      .|||       .|:||..||.|....||:.:.|  
Mosquito     7 LVLLATSSLLLVATSSREIRSAQDVDWSQVSRFYDPKADAVPDRRINNGQIASPTDAPWAVGLLV 71

  Fly    56 QGISGAHSCGGAIINETFVLTAAHCVE-----NAFIPWLVVVTGTNKYNQPGGRYFLKAIH--IH 113
            ...||...||||:|:.|.|||||.||.     .|.:....:.|.::         |:...|  :|
Mosquito    72 SLASGTSFCGGALISPTHVLTAASCVNGQSSITAMLGASTIATTSD---------FVPVAHVRVH 127

  Fly   114 CNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDE-----VILTGWGSTVLWGTS--- 170
            .:|.:....:|||:|.|.....|:::.|.|.||. .|..|..     ..::|||.|   ||:   
Mosquito   128 PDYSSFLERDDIAILTLSRQPRWNDQIQIINLPR-RMYIGHSFNNYVTTISGWGET---GTNTGE 188

  Fly   171 PI---DLQVLYLQYVPHRECKA--LLSNDEDCDVGHICTFSRLGEGACHGDSGGP--LVSNG--Y 226
            |:   :|:.:....:.:..|:.  ||:|....   ||||.:. |...|.||.|.|  :..||  :
Mosquito   189 PLPMPNLRFIRSPVITNLSCELSFLLTNIRST---HICTATD-GGAPCVGDQGAPVTVTENGETF 249

  Fly   227 LVGL-VNWGWPCATGVPDVHASVYFYRDWI 255
            |:|: |.....|..|.|.||..:..|.:|:
Mosquito   250 LIGIHVFTASRCERGRPAVHVRLTEYMNWL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 74/244 (30%)
Tryp_SPc 38..258 CDD:238113 74/245 (30%)
AgaP_AGAP005703XP_001688713.1 Tryp_SPc 51..278 CDD:214473 74/243 (30%)
Tryp_SPc 52..282 CDD:238113 74/245 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.