DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP006488

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_001688886.1 Gene:AgaP_AGAP006488 / 5667298 VectorBaseID:AGAP006488 Length:260 Species:Anopheles gambiae


Alignment Length:282 Identity:66/282 - (23%)
Similarity:101/282 - (35%) Gaps:80/282 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GLVSITAIRIKGNSTDGRFYKDQRIIGGQAAED------GFAPYQISLQGISGAHS-CGGAIINE 71
            |...||:|.:.|           .|:|.||..:      ||..|...:...:..|. |.|.:||.
Mosquito     2 GKAVITSIVLLG-----------AILGCQAQTETVVRNVGFGEYPSVVFVSTPRHQRCMGTVINA 55

  Fly    72 TFVLTAAHCVEN--------AFIPWLV---------VVTGTNKYNQPGGRYFLKAIHIHCNYDNP 119
            ..|||:..||..        |.:..:|         |||...:..|        .|.:|.::...
Mosquito    56 NHVLTSGTCVMTDGAARIYPALLVQVVGGDLSVPNPVVTQQTRVAQ--------HIFVHEHFRPR 112

  Fly   120 EMHNDIALLELVEPIAWDE---RTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQY 181
            ...|::|::.|.||.....   ....|.:.:||.....:|:     .|.|.| ||: ||...:|.
Mosquito   113 TNDNNVAIIRLAEPFHLPSNGIEEAHIRMRIVPQGHQCDVV-----RTTLTG-SPV-LQAYNVQI 170

  Fly   182 VPHRECKALLSNDEDC-----DVGHICTFS-RLGEGACHGDSGGPLVSNGYLVGLVNWGWPCATG 240
            .....|      |..|     :..:|||.. .:.:....|||   :..:|.|..:      .||.
Mosquito   171 RNRNLC------DSCCLDIFREESNICTEPITISDSLLQGDS---MFCDGELTAI------AATV 220

  Fly   241 VP-----DVHAS-VYFYRDWIR 256
            |.     :.|.: |.|:..||:
Mosquito   221 VSNDQTREFHFNQVRFFTHWIQ 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 59/256 (23%)
Tryp_SPc 38..258 CDD:238113 61/258 (24%)
AgaP_AGAP006488XP_001688886.1 Tryp_SPc 32..222 CDD:304450 49/219 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.