DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP006673

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_001688952.1 Gene:AgaP_AGAP006673 / 5667010 VectorBaseID:AGAP006673 Length:307 Species:Anopheles gambiae


Alignment Length:321 Identity:92/321 - (28%)
Similarity:127/321 - (39%) Gaps:78/321 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGL-------SGLVSITAIRIKGNSTDGRFYK---------------DQRIIGGQA 43
            |..|....|:||       ..|:.|...|:|......|:::               .:||..||.
Mosquito     1 MKLVAAFALVGLLATLASARSLLDIDPARVKSIEEYDRYWRRLPAELQYLRTVEQPTRRITNGQL 65

  Fly    44 AEDGFAPYQ--ISLQGISGAHS-CGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRY 105
            |..|..|||  :..:...|.:| |||.|:..|:||||||||.:.|..   .||        ||..
Mosquito    66 ATAGQFPYQAVVYSEAGDGYYSLCGGTILTTTYVLTAAHCVTDDFDR---AVT--------GGIV 119

  Fly   106 FLKA-------------------IHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVP-- 149
            ||.|                   |.:|..|::..:.||||.:.|.....::...:.|.||.:.  
Mosquito   120 FLGATDRTVFQSTQQRMSFGNAGIRVHPQYNSTSIRNDIATVRLDTAAIFNTYVKAIDLPALSDA 184

  Fly   150 -MQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVP---HRECKALLSNDEDCDVGHICTFSRLGE 210
             ...|.|...:|:|.|.  .|.|....||.....|   :.:|.|..|. ......::|.....|.
Mosquito   185 RQFGGFEGTASGFGRTA--DTVPAASNVLMFVRNPVMTNAQCNAYWST-AVVQAQNVCLDPYGGR 246

  Fly   211 GACHGDSGGPL----VSNGYLVGLVNW----GWPCATGVPDVHASVYFYRDWIRNVMSGNS 263
            .||||||||||    ......||:.::    |  |.:|.|.|...|.::||:|    |.||
Mosquito   247 SACHGDSGGPLAVQDAGRSLQVGIASFVSANG--CTSGAPSVWVRVSYFRDFI----SQNS 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 78/253 (31%)
Tryp_SPc 38..258 CDD:238113 78/255 (31%)
AgaP_AGAP006673XP_001688952.1 Tryp_SPc 59..297 CDD:214473 78/253 (31%)
Tryp_SPc 60..300 CDD:238113 79/259 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.