DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP005597

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_001688690.1 Gene:AgaP_AGAP005597 / 5666842 VectorBaseID:AGAP005597 Length:275 Species:Anopheles gambiae


Alignment Length:251 Identity:64/251 - (25%)
Similarity:94/251 - (37%) Gaps:52/251 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 STDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAH-CVENAFIPWL- 89
            :|:|  ||.   :.||.....:...:|..:..:....|.||:|...::|:... |::...:..: 
Mosquito    46 ATNG--YKS---LPGQFLYHAYMHIRIESELSNYTRLCDGALITSNYILSVTQGCLQVGSMQTIR 105

  Fly    90 --VVVTGTNKYNQPGGRYFL-KAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQ 151
              ..:...||.|......|. .||::|       .:..|.|:.|..|...:|..|.|.||.:.  
Mosquito   106 NGTAILAFNKNNWEQRITFSGSAINLH-------PYKSIGLVRLDYPATLNEHVQLIRLPKLT-- 161

  Fly   152 PGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDE-----------DCDVGHICTF 205
              |.....|...|    ||.     .|..||.:|    ::||..           |.|   |||.
Mosquito   162 --DSRSYEGMEGT----TSN-----QYRSYVRNR----VMSNAHCSQERPDFNATDMD---ICTD 208

  Fly   206 SRLGEGACHGDSGGPLV---SNG-YLVGLVNWGWPCATGVPDVHASVYFYRDWIRN 257
            ..:|...|....|..|.   .|| .|:||....:.|....|.|:|.|..:||||.|
Mosquito   209 RYIGGAFCSTSLGSSLTIEDENGVILIGLAYRIYYCDYNYPTVYARVSSFRDWIHN 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 57/237 (24%)
Tryp_SPc 38..258 CDD:238113 60/240 (25%)
AgaP_AGAP005597XP_001688690.1 Tryp_SPc 48..265 CDD:304450 63/249 (25%)
Tryp_SPc 48..262 CDD:214473 60/245 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.