DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP005596

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_001688689.1 Gene:AgaP_AGAP005596 / 5666841 VectorBaseID:AGAP005596 Length:266 Species:Anopheles gambiae


Alignment Length:264 Identity:68/264 - (25%)
Similarity:99/264 - (37%) Gaps:73/264 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IKGNSTDGRFYKDQRIIGGQAAEDGFAPYQ--------ISLQGISGAHSCGGAIINETFVLTAAH 79
            |:..||:.|.           |..|:||:.        |...|:    .|.||:|...::::.|.
Mosquito    36 IEAMSTENRL-----------ATYGYAPFPGQFPYLTFIENNGV----VCNGALITPNYIVSVAR 85

  Fly    80 -CVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPI 143
             |:..:.|......|....:|:   ..:.:.|:...:..|...:.||||..|..|...::..|||
Mosquito    86 GCLNRSTIKTAQYGTAILAFNK---NMWEQRINFSASAINLHPYEDIALARLNYPATLNKHVQPI 147

  Fly   144 PLP-------LVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGH 201
            .||       .|.|:          |:||...           :||.:|    ::||.| |...|
Mosquito   148 RLPKLSDSRSYVDME----------GTTVATN-----------RYVRNR----VMSNAE-CTKEH 186

  Fly   202 ---------ICTFSRLGEGACHGDSGGPLV---SNG-YLVGLVNWGWPCATGVPDVHASVYFYRD 253
                     |||....|...|....|.||.   .|| .|:||.||...|....|..:|.:..:||
Mosquito   187 PNFNATHVDICTDRYKGGAFCSFFLGSPLTIEDENGVILIGLANWISSCDNNYPTGYARILPFRD 251

  Fly   254 WIRN 257
            ||.|
Mosquito   252 WIHN 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 61/246 (25%)
Tryp_SPc 38..258 CDD:238113 64/249 (26%)
AgaP_AGAP005596XP_001688689.1 Tryp_SPc 54..256 CDD:304450 60/235 (26%)
Tryp_SPc 54..253 CDD:214473 57/231 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.