DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and TMPRSS4

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_005271670.1 Gene:TMPRSS4 / 56649 HGNCID:11878 Length:494 Species:Homo sapiens


Alignment Length:287 Identity:93/287 - (32%)
Similarity:131/287 - (45%) Gaps:43/287 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSG-LVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVL 75
            ||| |||:..:..      |:..|..|::|.:.|.....|:|:|:| ....|.|||:|::..:||
Human   184 LSGSLVSLHCLAC------GKSLKTPRVVGVEEASVDSWPWQVSIQ-YDKQHVCGGSILDPHWVL 241

  Fly    76 TAAHCV--ENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDE 138
            |||||.  ......| .|..|::|..........|.|.|..|...|: .|||||::|..|:.:..
Human   242 TAAHCFRKHTDVFNW-KVRAGSDKLGSFPSLAVAKIIIIEFNPMYPK-DNDIALMKLQFPLTFSG 304

  Fly   139 RTQPIPLPLV--PMQPGDEVILTGWGSTVLWG--TSPIDLQVLYLQYVPHRECKALLSNDEDCDV 199
            ..:||.||..  .:.|...:.:.|||.|...|  .|.|.||. .:|.:....|     |.:|...
Human   305 TVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQA-SVQVIDSTRC-----NADDAYQ 363

  Fly   200 GHI-----CTFSRLGEG---ACHGDSGGPLV---SNGYLVGLVNWGWPC-ATGVPDVHASVYFYR 252
            |.:     |  :.:.||   .|.|||||||:   ...::||:|:||:.| ....|.|:..|..|.
Human   364 GEVTEKMMC--AGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAYL 426

  Fly   253 DWIRNV-------MSGNSKCTGFSSNQ 272
            :||.||       .|.||..||....|
Human   427 NWIYNVWKDRTIQRSCNSPGTGLVIQQ 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/235 (32%)
Tryp_SPc 38..258 CDD:238113 76/237 (32%)
TMPRSS4XP_005271670.1 LDLa 58..92 CDD:238060
SRCR_2 108..197 CDD:295335 6/18 (33%)
Tryp_SPc 204..429 CDD:214473 75/235 (32%)
Tryp_SPc 205..432 CDD:238113 76/237 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147506
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.