DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Klk4

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_064312.1 Gene:Klk4 / 56640 MGIID:1861379 Length:255 Species:Mus musculus


Alignment Length:238 Identity:72/238 - (30%)
Similarity:116/238 - (48%) Gaps:25/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN-- 99
            |||.||.......|:|.:|....| ..|.|.:::..:||:||||::.::|      .|...:|  
Mouse    31 RIIQGQDCSPHSQPWQAALFSEDG-FFCSGVLVHPQWVLSAAHCLQESYI------VGLGLHNLK 88

  Fly   100 ---QPGGRYFLKAIHI-HCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTG 160
               :||.|.....:.| |.|:::|...||:.|::|.|.:......:.||:......|||..:::|
Mouse    89 GSQEPGSRMLEAHLSIQHPNFNDPSFANDLMLIKLNESVIESNTIRSIPVATQCPTPGDTCLVSG 153

  Fly   161 WGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLG----EGACHGDSGGPL 221
            ||. :..|..|..||.:.|.......|:.|..     .|.|:..|...|    :.:|:||||||:
Mouse   154 WGQ-LKNGKLPSLLQCVNLSVASEETCRLLYD-----PVYHLSMFCAGGGQDQKDSCNGDSGGPI 212

  Fly   222 VSNGYLVGLVNWG-WPCA-TGVPDVHASVYFYRDWIRNVMSGN 262
            |.|..|.|||:.| ..|. .|:|.|:.::..:.:||:.::..|
Mouse   213 VCNRSLQGLVSMGQGKCGQPGIPSVYTNLCKFTNWIQTIIQTN 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 69/229 (30%)
Tryp_SPc 38..258 CDD:238113 70/231 (30%)
Klk4NP_064312.1 Tryp_SPc 32..251 CDD:238113 70/231 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837572
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.