DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AZU1

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001691.1 Gene:AZU1 / 566 HGNCID:913 Length:251 Species:Homo sapiens


Alignment Length:267 Identity:81/267 - (30%)
Similarity:119/267 - (44%) Gaps:39/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLLILLGLSGLVSITAIRIKGNS--TDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGA 67
            ||.:|.||  |.|..|    |:|  .|        |:||:.|.....|:..|:|. .|.|.||||
Human     6 VLALLAGL--LASSRA----GSSPLLD--------IVGGRKARPRQFPFLASIQN-QGRHFCGGA 55

  Fly    68 IINETFVLTAAHCVENAFIPWLVVVTGT----NKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALL 128
            :|:..||:|||.|.::.......||.|.    .:..|....:.:.::..: .||..:..||:.||
Human    56 LIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSEN-GYDPQQNLNDLMLL 119

  Fly   129 ELVEPIAWDERTQPIPLPL--VPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALL 191
            :|............:||||  ..::.|....:.||||....|.         |...| |.....:
Human   120 QLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGR---------LSRFP-RFVNVTV 174

  Fly   192 SNDEDCDVGHICT--FSRLGEGACHGDSGGPLVSNGYLVGLVNWG-WPCATGVPDVHASVYFYRD 253
            :.::.|...::||  .:|.| |.|:||.|.|||..|...|:.::. .||..| ||....|..:||
Human   175 TPEDQCRPNNVCTGVLTRRG-GICNGDGGTPLVCEGLAHGVASFSLGPCGRG-PDFFTRVALFRD 237

  Fly   254 WIRNVMS 260
            ||..|::
Human   238 WIDGVLN 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 67/226 (30%)
Tryp_SPc 38..258 CDD:238113 69/228 (30%)
AZU1NP_001691.1 Tryp_SPc 27..240 CDD:238113 68/226 (30%)
Possesses antibiotic activity. /evidence=ECO:0000269|PubMed:8506327 46..70 13/24 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.