DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and PRTN3

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_002768.3 Gene:PRTN3 / 5657 HGNCID:9495 Length:256 Species:Homo sapiens


Alignment Length:275 Identity:92/275 - (33%)
Similarity:123/275 - (44%) Gaps:56/275 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQ--GISGAHSCG 65
            |.|||.|| |||..                 :...|:||..|:....||..|||  |..|:|.||
Human    11 ASVLLALL-LSGAA-----------------RAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCG 57

  Fly    66 GAIINETFVLTAAHCVENAFIPWLV--VVTGTN--KYNQPGGRYFLKAIHIHCNYDNPEMHNDIA 126
            |.:|:.:||||||||:.:  ||..:  ||.|.:  :..:|..::|..|.....|||.....||:.
Human    58 GTLIHPSFVLTAAHCLRD--IPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVL 120

  Fly   127 LLELVEPIAWDERTQPIPLPL--VPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYV-----PH 184
            |::|..|.........:.||.  .|:..|.:.:..|||...........||.|.:..|     ||
Human   121 LIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPH 185

  Fly   185 RECKALLSNDEDCDVGHICTF-SRLGEGACHGDSGGPLVSNGYLVGL---VNWGWPCATGV-PDV 244
                            :|||| .|...|.|.|||||||:.:|.:.|:   |.||  |||.: ||.
Human   186 ----------------NICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWG--CATRLFPDF 232

  Fly   245 HASVYFYRDWIRNVM 259
            ...|..|.||||:.:
Human   233 FTRVALYVDWIRSTL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 80/235 (34%)
Tryp_SPc 38..258 CDD:238113 83/237 (35%)
PRTN3NP_002768.3 Tryp_SPc 28..246 CDD:238113 83/237 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.