DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Klk11

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001170844.1 Gene:Klk11 / 56538 MGIID:1929977 Length:276 Species:Mus musculus


Alignment Length:271 Identity:82/271 - (30%)
Similarity:126/271 - (46%) Gaps:38/271 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINET 72
            ::|.|..|..:|          |....:.|||.|........|:|::|...:.. .||..:|...
Mouse    28 MILRLIALALVT----------GHVGGETRIIKGYECRPHSQPWQVALFQKTRL-LCGATLIAPK 81

  Fly    73 FVLTAAHCVENAFIPWLVVVTGTNKYNQPGG---RYFLKAIHIHCNYD----NPEMHNDIALLEL 130
            ::||||||.:    |..|::.|.:...:..|   |........|.:::    |.:..|||.|:::
Mouse    82 WLLTAAHCRK----PHYVILLGEHNLEKTDGCEQRRMATESFPHPDFNNSLPNKDHRNDIMLVKM 142

  Fly   131 VEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTS-----PIDLQVLYLQYVPHREC-KA 189
            ..|:.:....||:.|....:..|...:::|||:|    :|     |..|:...:..:.|:|| ||
Mouse   143 SSPVFFTRAVQPLTLSPHCVAAGTSCLISGWGTT----SSPQLRLPHSLRCANVSIIEHKECEKA 203

  Fly   190 LLSNDEDCDVGHICTFSRL-GEGACHGDSGGPLVSNGYLVGLVNWGW-PCA-TGVPDVHASVYFY 251
            ...|..|.   .:|...|. |:.:|.||||||||.||.|.|:::||. ||| |..|.|:..|..|
Mouse   204 YPGNITDT---MLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKVCKY 265

  Fly   252 RDWIRNVMSGN 262
            .:||..||..|
Mouse   266 FNWIHEVMRNN 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/233 (31%)
Tryp_SPc 38..258 CDD:238113 73/235 (31%)
Klk11NP_001170844.1 Tryp_SPc 47..269 CDD:214473 72/233 (31%)
Tryp_SPc 48..272 CDD:238113 73/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837592
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.