DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and si:dkey-33m11.7

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_021335658.1 Gene:si:dkey-33m11.7 / 565163 ZFINID:ZDB-GENE-141216-115 Length:214 Species:Danio rerio


Alignment Length:193 Identity:59/193 - (30%)
Similarity:87/193 - (45%) Gaps:27/193 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 GTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPL--VPMQPGDEV 156
            ||.:|::|     |..|. |..|:....:.||.|::|..||..:......|||.  ..:..|...
Zfish    18 GTEQYSKP-----LMLIP-HPLYNRSTNNADIMLIKLSAPIELNRYVSLAPLPKQNTGLLAGRMC 76

  Fly   157 ILTGWGSTV-LWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLG---------EG 211
            .::|||||. ..|..|:.|:.:.|..|...:|.:..|...:.....||..|..|         :.
Zfish    77 RVSGWGSTSHSGGLIPLTLRTVRLPIVSTFKCNSSSSFSGNITANMICAGSSTGGKDACKNSTQY 141

  Fly   212 ACH-------GDSGGPLVSNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWI-RNVMSGNSKC 265
            .||       ||||||||.:|.:.|||:||..|. ...|.|:.:|..:|.|| :.:.|..::|
Zfish   142 LCHLIVYLCQGDSGGPLVCDGRVYGLVSWGNGCGDPRFPGVYTAVSRFRRWIDQTIYSTYARC 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 55/180 (31%)
Tryp_SPc 38..258 CDD:238113 57/184 (31%)
si:dkey-33m11.7XP_021335658.1 Tryp_SPc <2..196 CDD:238113 57/183 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.