DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and si:dkey-33m11.8

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_693464.3 Gene:si:dkey-33m11.8 / 565078 ZFINID:ZDB-GENE-141215-49 Length:251 Species:Danio rerio


Alignment Length:245 Identity:83/245 - (33%)
Similarity:130/245 - (53%) Gaps:29/245 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKY 98
            |.|||||||..:.....||.|:| .:..|.|||.:|:..:|::||||...:::  :.||...:..
Zfish    20 KQQRIIGGQEVQPYSIKYQASVQ-YNNYHYCGGTLIHPQWVVSAAHCWRPSYL--IKVVLSEHDL 81

  Fly    99 NQPGG--RYF--LKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPL-VP-MQPGDEVI 157
            ::..|  |.|  .||: :|..|:.....:||.||:|.:|.......||..||: || :|.|...|
Zfish    82 SKIEGFERVFNVSKAL-VHYMYNYRTFDSDIMLLKLEKPAELSATIQPAVLPVSVPALQGGTVCI 145

  Fly   158 LTGWGSTVLWG--TSPIDLQVLYLQYVPHRECK-----ALLSNDEDCDVGHICTFSRL-GEGACH 214
            ::|||.|.::.  .||: |:.:.:|.:|  :|:     .:..|       .:|..|.| |:.:|.
Zfish   146 VSGWGVTQVYSYYLSPV-LRAVDVQIIP--QCQYYYYYRITDN-------MVCAGSPLGGKDSCQ 200

  Fly   215 GDSGGPLVSNGYLVGLVNWGWPCATG-VPDVHASVYFYRDWIRNVMSGNS 263
            |||||||:.|||..|:|:||..||.. .|.|:..|..|..|:..::..::
Zfish   201 GDSGGPLICNGYFEGIVSWGISCANAYFPGVYTKVRNYIPWMTWIIDNDT 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 80/232 (34%)
Tryp_SPc 38..258 CDD:238113 80/234 (34%)
si:dkey-33m11.8XP_693464.3 Tryp_SPc 23..241 CDD:214473 80/231 (35%)
Tryp_SPc 24..241 CDD:238113 79/230 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.