DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and KLK7

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_005037.1 Gene:KLK7 / 5650 HGNCID:6368 Length:253 Species:Homo sapiens


Alignment Length:269 Identity:79/269 - (29%)
Similarity:115/269 - (42%) Gaps:41/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINET 72
            :||.|..|:...|:...|....|     .:||.|.....|..|:|::|...:..| |||.::||.
Human     5 LLLPLQILLLSLALETAGEEAQG-----DKIIDGAPCARGSHPWQVALLSGNQLH-CGGVLVNER 63

  Fly    73 FVLTAAHCVENAFIPWL----------VVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIAL 127
            :|||||||..|.:...|          ..:..:..:..||             |......||:.|
Human    64 WVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPG-------------YSTQTHVNDLML 115

  Fly   128 LELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWG-TSPIDLQVLYLQYVPHREC---- 187
            ::|..........:.:.||.....||....::|||:|.... |.|.||..:.::.:..::|    
Human   116 VKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVY 180

  Fly   188 KALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWG-WPCA-TGVPDVHASVYF 250
            |.||.|...|     .......:.||:||||||||..|.|.|||:|| :||. ...|.|:..|..
Human   181 KDLLENSMLC-----AGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCK 240

  Fly   251 YRDWIRNVM 259
            :..||.:.|
Human   241 FTKWINDTM 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 69/234 (29%)
Tryp_SPc 38..258 CDD:238113 71/236 (30%)
KLK7NP_005037.1 Tryp_SPc 29..245 CDD:214473 69/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147514
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.