DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and PRSS3

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:241 Identity:89/241 - (36%)
Similarity:130/241 - (53%) Gaps:20/241 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTN 96
            |..|.:|:||...|:...|||:||.  ||:|.|||::|:|.:|::||||.:..    :.|..|.:
Human   104 FDDDDKIVGGYTCEENSLPYQVSLN--SGSHFCGGSLISEQWVVSAAHCYKTR----IQVRLGEH 162

  Fly    97 KYN-QPGGRYFLKAIHI--HCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVIL 158
            ... ..|...|:.|..|  |..|:...:.|||.|::|..|...:.|...|.||..|...|.|.::
Human   163 NIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLI 227

  Fly   159 TGWGSTVLWGTS-PIDLQVLYLQYVPHRECKA----LLSNDEDCDVGHICTFSRLGEGACHGDSG 218
            :|||:|:.:|.. |.:|:.|....:...||||    .::|...| ||    |...|:.:|..|||
Human   228 SGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFC-VG----FLEGGKDSCQRDSG 287

  Fly   219 GPLVSNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVMSGNS 263
            ||:|.||.|.|:|:||..|| ...|.|:..||.|.|||::.::.||
Human   288 GPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 83/226 (37%)
Tryp_SPc 38..258 CDD:238113 85/228 (37%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 83/226 (37%)
Tryp_SPc 110..328 CDD:238113 85/228 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.