DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and PRSS1

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:292 Identity:94/292 - (32%)
Similarity:141/292 - (48%) Gaps:51/292 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSGLVSITA--------IRIKGNSTD-----------------------GRFYKDQRIIGGQAAE 45
            |.|:|::|:        :|.|..|:.                       ..|..|.:|:||...|
Human   192 LGGVVTLTSQSPPLWILVRYKDESSTTSQAHSTTMNPLLILTFVAAALAAPFDDDDKIVGGYNCE 256

  Fly    46 DGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN-QPGGRYFLKA 109
            :...|||:||.  ||.|.|||::|||.:|::|.||.::.    :.|..|.:... ..|...|:.|
Human   257 ENSVPYQVSLN--SGYHFCGGSLINEQWVVSAGHCYKSR----IQVRLGEHNIEVLEGNEQFINA 315

  Fly   110 IHI--HCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTS-P 171
            ..|  |..||...::|||.|::|......:.|...|.||..|...|.:.:::|||:|...|.. |
Human   316 AKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYP 380

  Fly   172 IDLQVLYLQYVPHRECKA----LLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVN 232
            .:||.|....:...:|:|    .::::..| ||    |...|:.:|.||||||:|.||.|.|:|:
Human   381 DELQCLDAPVLSQAKCEASYPGKITSNMFC-VG----FLEGGKDSCQGDSGGPVVCNGQLQGVVS 440

  Fly   233 WGWPCA-TGVPDVHASVYFYRDWIRNVMSGNS 263
            ||..|| ...|.|:..||.|..||:|.::.||
Human   441 WGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 80/226 (35%)
Tryp_SPc 38..258 CDD:238113 82/228 (36%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 80/226 (35%)
Tryp_SPc 249..467 CDD:238113 82/228 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.