DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and si:ch1073-280e3.1

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_009289626.1 Gene:si:ch1073-280e3.1 / 563828 ZFINID:ZDB-GENE-110411-261 Length:831 Species:Danio rerio


Alignment Length:272 Identity:62/272 - (22%)
Similarity:103/272 - (37%) Gaps:83/272 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTN------KYNQPGGRYFLK 108
            |:.:.|  :.|..:|.|:|::|:.|||||||        |:..:|..      |.....|.  :|
Zfish   567 PWHVDL--LWGTKTCRGSIVSESMVLTAAHC--------LIKASGVKATPADIKITHGAGE--VK 619

  Fly   109 AIH--IHCNY--------DNPEMHN-DIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWG 162
            |:.  :|..:        |..|.:: ||||:.:.|.|....:|:||.||..  :..:..:....|
Zfish   620 AVELIVHSQFNVSGLKDKDVKEFYDYDIALIRMKENITISRQTRPICLPCT--KSSNRALRMAAG 682

  Fly   163 STVLWGTSPIDLQVLYLQYVP--------HR----------------ECKALLSNDEDCDVGHIC 203
            ||    ....:..:|:|:..|        ||                :.:::|..:....:..|.
Zfish   683 ST----CDQHERVLLHLEETPAHFISQGTHRADTHVHSGAKREKCTEKARSVLQENSRATLTDII 743

  Fly   204 TFSRLGEG---------ACHGDSGGPLV----SNGYLVGLVNWG--WPC---------ATGVPDV 244
            |...:..|         .|.|||||.|.    ...:.|.:::||  ..|         .....|.
Zfish   744 TERFMCTGGSDRNTHHITCKGDSGGALFLRRRMRHFQVAVISWGSKQTCDSRTEHREAVQDASDF 808

  Fly   245 HASVYFYRDWIR 256
            |.||:....|::
Zfish   809 HTSVFTLMPWLK 820

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 61/269 (23%)
Tryp_SPc 38..258 CDD:238113 62/272 (23%)
si:ch1073-280e3.1XP_009289626.1 CCP 36..93 CDD:153056
CCP 108..156 CDD:214478
CCP 176..231 CDD:153056
CCP 238..291 CDD:153056
vWFA 340..538 CDD:294047
Tryp_SPc 567..822 CDD:238113 62/272 (23%)
Tryp_SPc 567..818 CDD:214473 61/268 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.