DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and zgc:112285

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001020685.1 Gene:zgc:112285 / 561476 ZFINID:ZDB-GENE-050913-132 Length:316 Species:Danio rerio


Alignment Length:259 Identity:77/259 - (29%)
Similarity:114/259 - (44%) Gaps:49/259 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QRIIGGQAAEDGFAPYQISLQ-----GISGAHSCGGAIINETFVLTAAHC-----VENAFIPWLV 90
            :||:.|..|.....|:|:|||     .....|.|||.:|::.:|||||||     .|:| ..|.:
Zfish    57 ERIVSGNEARPHSWPWQVSLQVRPRGSKHYVHVCGGTLIHKNWVLTAAHCFQKGKAEDA-SSWRI 120

  Fly    91 VVTGTN--KYNQPGGRYF-LKAIHIHCNYDNP---EMHNDIALLELVEPIAWDERTQP------- 142
            |: |.:  |.::...|:| :|.|:.|.::..|   |:..||||::....|      ||       
Zfish   121 VL-GKHQLKRSETAERFFPVKRIYRHEHFRYPAHSELDYDIALVKAATDI------QPSNFIRYA 178

  Fly   143 -IPLPLVPMQPGDEVILTGWGSTVLWGTSPID----LQVLYLQYVPHRECKALLSNDEDCDVGHI 202
             :|...:.:.||....:||||.| ..|...:.    |....|..:.::.|:......:......|
Zfish   179 CLPRKQINLNPGHYCWVTGWGDT-RGGKENVSLAEALNQARLPIIDYKTCRQKKFWGDRVRDSMI 242

  Fly   203 CTFSRLGEG---ACHGDSGGPLV-----SNGYLVGLVNWGWPCATGV---PDVHASVYFYRDWI 255
            |...|..||   ||.|||||||:     ....:.|:|::| |....|   |.|......|..||
Zfish   243 CAGFRDTEGTPAACQGDSGGPLLCQVGRDRWEVHGIVSFG-PIGCTVENKPSVFTRTAAYIPWI 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/256 (29%)
Tryp_SPc 38..258 CDD:238113 76/257 (30%)
zgc:112285NP_001020685.1 Tryp_SPc 58..305 CDD:214473 75/256 (29%)
Tryp_SPc 59..308 CDD:238113 76/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.