DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and LOC560023

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_021325702.1 Gene:LOC560023 / 560023 -ID:- Length:271 Species:Danio rerio


Alignment Length:249 Identity:84/249 - (33%)
Similarity:117/249 - (46%) Gaps:40/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQ 100
            |||||||........||:||| :...|.|||.:|...:|||||||    :.|..|:....:::|.
Zfish    42 QRIIGGQEVVPYSIKYQVSLQ-VDRKHFCGGTLIQPQWVLTAAHC----WRPASVIQVVLSEHNL 101

  Fly   101 PGGRYF-----LKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLV---PMQPGDEVI 157
            .....|     :..:..|..|:....:|||.:::|..|...:...||..||..   .:..|....
Zfish   102 AVEEGFEQVCTVAKVFSHVAYNPKTFNNDIMIIKLTAPAQINAYVQPALLPTADTPELAGGSSCT 166

  Fly   158 LTGWGSTVLWG--TSPI----DLQV-----LYLQYVPHRECKALLSNDEDCDVGHICTFSRL-GE 210
            ::|||.|.|:.  .|||    |:::     ||..|         ..||     ..||..||. |:
Zfish   167 VSGWGVTRLYNFYLSPILRAVDVEIFSSCQLYYYY---------RVND-----NMICAGSRFGGK 217

  Fly   211 GACHGDSGGPLVSNGYLVGLVNWGWPCATG-VPDVHASVYFYRDWIRNVMSGNS 263
            .:|.|||||||:.:|||.|:|:||..||.. .|.|:..|..|..||..::|..|
Zfish   218 DSCQGDSGGPLICDGYLEGIVSWGIGCALPYYPGVYTKVRNYNRWIDWIISTES 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 79/238 (33%)
Tryp_SPc 38..258 CDD:238113 80/240 (33%)
LOC560023XP_021325702.1 Tryp_SPc 43..263 CDD:214473 79/238 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.