DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and KLK15

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:272 Identity:87/272 - (31%)
Similarity:130/272 - (47%) Gaps:35/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINET 72
            :||.||.|::.||      :.||    |:.:.|.:.|... .|:|::|.. .|..:||.::|:..
Human     3 LLLTLSFLLASTA------AQDG----DKLLEGDECAPHS-QPWQVALYE-RGRFNCGASLISPH 55

  Fly    73 FVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKA---IHIHCNYDNPEMHNDIALLELVEPI 134
            :||:||||...    ::.|..|.:...:..|...|:.   :..|..|:.....|||.||.||:|.
Human    56 WVLSAAHCQSR----FMRVRLGEHNLRKRDGPEQLRTTSRVIPHPRYEARSHRNDIMLLRLVQPA 116

  Fly   135 AWDERTQPIPLPLVPMQPGDEVILTGWG--STVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDC 197
            ..:.:.:|..||.....||:..:::|||  |....||:......:.|....|....:::| |..|
Human   117 RLNPQVRPAVLPTRCPHPGEACVVSGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIIS-DTSC 180

  Fly   198 DVGH--------ICTFSRLGEGA--CHGDSGGPLVSNGYLVGLVNWG-WPC-ATGVPDVHASVYF 250
            |..:        :|..:. |.||  |.||||||||..|.|.|:|:|| .|| .|..|.|:..|..
Human   181 DKSYPGRLTNTMVCAGAE-GRGAESCEGDSGGPLVCGGILQGIVSWGDVPCDNTTKPGVYTKVCH 244

  Fly   251 YRDWIRNVMSGN 262
            |.:|||..|..|
Human   245 YLEWIRETMKRN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/234 (31%)
Tryp_SPc 38..258 CDD:238113 75/236 (32%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 72/231 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.