DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and zgc:112038

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:258 Identity:80/258 - (31%)
Similarity:119/258 - (46%) Gaps:45/258 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GGQAAEDGFAPYQISLQGISGA-HSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGG 103
            ||..|..|..|:|.|:..||.. |.|||::||:.:||:||||         .::|.|.......|
Zfish    37 GGDDAVAGSWPWQASIHRISPEDHICGGSLINKDWVLSAAHC---------FMITATANIKIFLG 92

  Fly   104 RYF------------LKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVP--MQPGD 154
            |.|            |..|.||.:|.....:||||||.|...:.:.:..:|:.|....  ...|.
Zfish    93 RQFQTGSNPNEISRTLTQIVIHPDYSTTTQNNDIALLRLSSSVTFTDYIRPVCLASADSVFAGGT 157

  Fly   155 EVILTGWG---STVLWGTSPIDLQVLYLQYVPHREC----KALLSNDEDCDVGHICTFSRLGEGA 212
            :..:|||.   |:.:..|:.  ||.:.|..|.:.||    |.:::::..|     ...:..|:.|
Zfish   158 KSWITGWDKHRSSDIQVTNV--LQEVQLPVVSNTECNADYKGIITDNMIC-----AGINEGGKDA 215

  Fly   213 CHGDSGGPLVS-NG---YLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVMSGNSKCTGFSS 270
            |.||||||:|| ||   ...|:|::|..|. ...|.::..|..|:.||.:.:..|  ..||.|
Zfish   216 CQGDSGGPMVSQNGSRWIQSGIVSFGRECGLPRYPGIYTRVSQYQSWITSELRTN--LPGFVS 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 74/241 (31%)
Tryp_SPc 38..258 CDD:238113 76/244 (31%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 74/241 (31%)
Tryp_SPc 37..263 CDD:238113 74/241 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.