DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and prss8

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001016980.1 Gene:prss8 / 549734 XenbaseID:XB-GENE-5758112 Length:329 Species:Xenopus tropicalis


Alignment Length:279 Identity:89/279 - (31%)
Similarity:134/279 - (48%) Gaps:31/279 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCG 65
            |..:.||.||    |::::...: |.|.:|   ...||:||..|.:|..|:|.||: ..|.|.||
 Frog     1 MEHLPLLSLL----LLAVSHFEL-GRSQEG---VQSRIVGGHDASEGMFPWQASLR-YDGNHVCG 56

  Fly    66 GAIINETFVLTAAHCV--ENAFIPWLVVVTGTNKYNQPGGR---YFLKAIHIHCNYDNPEMHNDI 125
            .|:|:..|::|||||.  :::.:.:.|.: |..:...|...   ..||.:.|:.:|.:.....|:
 Frog    57 AALISANFIVTAAHCFPSDHSLVGYSVYL-GVLQLGVPSSNSQLLKLKQVTIYPSYSHDTSSGDL 120

  Fly   126 ALLELVEPIAWDERTQPIPLPLVPMQ-P-GDEVILTGWGSTVLWGTSP--IDLQVLYLQYVPHRE 186
            |:..|..|..:....|||.||...:| | |....:||||:.......|  .:|||..::.:..:.
 Frog   121 AVAALDSPATFSHVVQPISLPAANVQFPIGMTCQVTGWGNIQQGVNLPGAKNLQVGNVKLIGRQT 185

  Fly   187 CKALLSNDEDCD-VGH-----ICTFSRLGE-GACHGDSGGPLVS--NG--YLVGLVNWGWPC-AT 239
            |..|.:.....| :|.     ||..|..|. .||.|||||||..  ||  ||..:|:||..| |.
 Frog   186 CNCLYNIKPSADSMGSIQPDMICAGSAAGSVDACQGDSGGPLTCTVNGKAYLAAVVSWGDECGAQ 250

  Fly   240 GVPDVHASVYFYRDWIRNV 258
            ..|.|:..:..|..||:.:
 Frog   251 NKPGVYILISAYASWIQGI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 78/238 (33%)
Tryp_SPc 38..258 CDD:238113 79/240 (33%)
prss8NP_001016980.1 Tryp_SPc 29..266 CDD:214473 78/238 (33%)
Tryp_SPc 30..269 CDD:238113 79/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.