DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and tpsg1

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_012826218.1 Gene:tpsg1 / 548372 XenbaseID:XB-GENE-5893000 Length:297 Species:Xenopus tropicalis


Alignment Length:248 Identity:83/248 - (33%)
Similarity:122/248 - (49%) Gaps:32/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGT---- 95
            |.||:|||.|..|..|:|: :..|.|:..||||:|:...|:|.|||::......:||:.|.    
 Frog    54 DNRIVGGQDAMKGKNPWQV-IVWIPGSGYCGGALISSNLVVTVAHCIDGFNASSVVVILGAYKIT 117

  Fly    96 ---NKYNQ-PGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVP--MQPGD 154
               |:.|. |     ::.|.||.:|:..:...|||||:|.:.:......||:.:|...  ..||.
 Frog   118 GNPNEENSVP-----VQQIIIHPSYNESDNSADIALLQLSQNVPITRYIQPVCVPSASTVFPPGQ 177

  Fly   155 EVILTGWGSTVL--WGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGH------ICTFSRLGE- 210
            ..::||||...|  ....|:.||...::.:...:||:...|.   .||.      ||....||: 
 Frog   178 NCVVTGWGDIELSVIPQRPVVLQETQVRLMSTEQCKSYYDNK---GVGSFIKDDMICAVDILGQR 239

  Fly   211 GACHGDSGGPLVS----NGYLVGLVNWGWPCATGVPDVHASVYFYRDWIRNVM 259
            |.|.||.|||||:    ...|||:.::|:.|....|.|:.||..|.|||:..|
 Frog   240 GPCLGDGGGPLVTYQNKQWNLVGVASFGFGCGNENPAVYTSVRAYIDWIQQYM 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 79/240 (33%)
Tryp_SPc 38..258 CDD:238113 80/242 (33%)
tpsg1XP_012826218.1 Tryp_SPc 56..288 CDD:214473 79/240 (33%)
Tryp_SPc 57..290 CDD:238113 80/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.