DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Mcpt9

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_062196.2 Gene:Mcpt9 / 54272 RGDID:3068 Length:248 Species:Rattus norvegicus


Alignment Length:263 Identity:65/263 - (24%)
Similarity:110/263 - (41%) Gaps:32/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISL---QGISGAHSCGGAII 69
            :.|.|..||::..:..:|.          .|:.|..::....||...:   ...|..:.|||.::
  Rat     1 MFLFLFFLVAVLPVNTEGG----------EILWGTESKPHSRPYMAFINFYDSNSDLNRCGGFLV 55

  Fly    70 NETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHI--HCNYDNPEMHNDIALLELVE 132
            .:..|:|||||....    :.|:.|.:...:......:..:..  |.|:::..:.|||.||:|..
  Rat    56 AKDIVMTAAHCNGRN----IKVILGAHNIKKRENTQVISVLKAKPHENFNSDSLVNDIMLLKLER 116

  Fly   133 PIAWDERTQPIPLPLVP--MQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDE 195
            ....:...:.|.||...  ::||....:.||| |:...|....||.:.|:....::|:.:..|..
  Rat   117 KAQLNGVVKTIALPRSQDWVKPGQVCTVAGWG-TLANCTLSNTLQEVNLEVQKGQKCQGMSRNYN 180

  Fly   196 D----CDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCATGVPDVHASVYFYRDWIR 256
            |    | ||:    ....:....||||||.|.||...|:|::.. |....|.|...:..:..||:
  Rat   181 DSIQLC-VGN----PNERKATAGGDSGGPFVCNGVAQGIVSYRL-CTWTPPRVFTRISSFIPWIQ 239

  Fly   257 NVM 259
            ..|
  Rat   240 KTM 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 57/228 (25%)
Tryp_SPc 38..258 CDD:238113 59/230 (26%)
Mcpt9NP_062196.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.