DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Cfd

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001071110.1 Gene:Cfd / 54249 RGDID:2498 Length:263 Species:Rattus norvegicus


Alignment Length:269 Identity:79/269 - (29%)
Similarity:121/269 - (44%) Gaps:23/269 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGG 66
            |:|.|:.|:.|...|.:...|             .||:|||.|.....||..|:| ::|.|.|||
  Rat     3 SSVYLVALVVLEAAVCVAQPR-------------GRILGGQEAMAHARPYMASVQ-VNGTHVCGG 53

  Fly    67 AIINETFVLTAAHCVENAFIPWLV-VVTGTNKYNQP---GGRYFLKAIHIHCNYDNPEMHNDIAL 127
            .:::|.:||:||||::......:| |:.|.:..:.|   ...|.::::.:|.......:.:|:.|
  Rat    54 TLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLML 118

  Fly   128 LELVEPIAWDERTQPIPLPLV--PMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKAL 190
            .:|....:.....:|:||...  .::||....:.|||.....|..|..||.|.:..:....|...
  Rat   119 FKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLR 183

  Fly   191 LSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWG-WPCAT-GVPDVHASVYFYRD 253
            ..:|.......:|..|...: .|.||||||||....:..:|.|| ..|.. ..|.|...|..|..
  Rat   184 TYHDGAITKNMMCAESNRRD-TCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVP 247

  Fly   254 WIRNVMSGN 262
            ||.||:|||
  Rat   248 WIENVLSGN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 65/225 (29%)
Tryp_SPc 38..258 CDD:238113 66/227 (29%)
CfdNP_001071110.1 Tryp_SPc 26..252 CDD:238113 66/227 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.