DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and prss60.2

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:301 Identity:93/301 - (30%)
Similarity:142/301 - (47%) Gaps:40/301 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGIS-GAHSC 64
            ::...|.:|:.:.|  |::.:.:.|.:.     .:.||:||..|.:|..|:|:|||... |.|.|
Zfish     4 LTCATLTLLICVKG--SLSQLNVCGQAP-----LNSRIVGGVNAPEGSWPWQVSLQSPRYGGHFC 61

  Fly    65 GGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPG------GRYFLKAIHIHCNYDNPEMHN 123
            ||::|:..:|||||||:.......|||..|  :..|.|      .|...|.| :|.:|::....|
Zfish    62 GGSLISSEWVLTAAHCLPGVSESSLVVYLG--RRTQQGVNTHETSRNVAKII-VHSSYNSNTNDN 123

  Fly   124 DIALLELVEPIAWDERTQPIPLPL--VPMQPGDEVILTGWGSTVLWGT---SPIDLQVLYLQYVP 183
            |||||.|...:.:::..:|:.|..  .....|....:||||. |..|.   :|..||...:..|.
Zfish   124 DIALLRLSSAVTFNDYIRPVCLAAQNSVYSAGTSSWITGWGD-VQAGVNLPAPGILQETMIPVVA 187

  Fly   184 HRECKALLSNDEDCDVGHICT-FSRLGEGACHGDSGGPLVSNGYLV----GLVNWGWPCA-TGVP 242
            :..|.|.|.:....: ..||. .::.|:..|.||||||:|:....|    |:.:||:.|| ...|
Zfish   188 NDRCNAQLGSGTVTN-NMICAGLAKGGKDTCQGDSGGPMVTRLCTVWIQAGITSWGYGCADPNSP 251

  Fly   243 DVHASVYFYRDWIRNVMSGN----------SKCTGFSSNQS 273
            .|:..|..|:.||.:.:|.|          |.||..|...|
Zfish   252 GVYTRVSQYQSWISSKISQNQPGFILFTPPSSCTSSSLTSS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 79/235 (34%)
Tryp_SPc 38..258 CDD:238113 80/237 (34%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 79/235 (34%)
Tryp_SPc 34..267 CDD:238113 80/237 (34%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.