DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and PLAU

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_002649.2 Gene:PLAU / 5328 HGNCID:9052 Length:431 Species:Homo sapiens


Alignment Length:251 Identity:74/251 - (29%)
Similarity:118/251 - (47%) Gaps:37/251 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAA----EDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPW-----LVVV 92
            :||||:..    :..||......:|.|..:.|||::|:..:|::|.||    ||.:     .:|.
Human   178 KIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHC----FIDYPKKEDYIVY 238

  Fly    93 TGTNKYN---QPGGRYFLKAIHIHCNY--DNPEMHNDIALLELVEP---IAWDERT-QPIPLPLV 148
            .|.::.|   |...::.::.:.:|.:|  |....|||||||::...   .|...|| |.|.||.:
Human   239 LGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSM 303

  Fly   149 PMQP--GDEVILTGWG----STVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFS- 206
            ...|  |....:||:|    :..|:   |..|::..::.:.||||:.......:.....:|... 
Human   304 YNDPQFGTSCEITGFGKENSTDYLY---PEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADP 365

  Fly   207 RLGEGACHGDSGGPLV----SNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRN 257
            :....:|.||||||||    ....|.|:|:||..|| ...|.|:..|..:..|||:
Human   366 QWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRS 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 71/247 (29%)
Tryp_SPc 38..258 CDD:238113 74/250 (30%)
PLAUNP_002649.2 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 34..57
KR 67..152 CDD:238056
Connecting peptide 152..177
Tryp_SPc 179..422 CDD:238113 74/250 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.