DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Elane

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_056594.2 Gene:Elane / 50701 MGIID:2679229 Length:265 Species:Mus musculus


Alignment Length:272 Identity:78/272 - (28%)
Similarity:116/272 - (42%) Gaps:41/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCG 65
            ::|::|.:.||...|.|                   .|:||:.|.....|:..|||. .|.|.||
Mouse    11 LAAMLLALFLGGPALAS-------------------EIVGGRPARPHAWPFMASLQR-RGGHFCG 55

  Fly    66 GAIINETFVLTAAHCVENAFIPWLVVVTGTNKY-NQPGGRYFLKAIHIHCN-YDNPEMHNDIALL 128
            ..:|...||::|||||.......:.||.|.:.. .|...|.......|..| :|..::.|||.::
Mouse    56 ATLIARNFVMSAAHCVNGLNFRSVQVVLGAHDLRRQERTRQTFSVQRIFENGFDPSQLLNDIVII 120

  Fly   129 ELVEPIAWDERTQPIPLPLVPMQPGDEV--ILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALL 191
            :|......:...|...||......||..  :..|||.......||..||.|.:..|.:. |:..:
Mouse   121 QLNGSATINANVQVAQLPAQGQGVGDRTPCLAMGWGRLGTNRPSPSVLQELNVTVVTNM-CRRRV 184

  Fly   192 SNDEDCDVGHICTF-SRLGEGACHGDSGGPLVSNGYLVGL---VNWGWPCATGV-PDVHASVYFY 251
                     ::||. .|...|.|.||||||||.|..:.|:   :..|  |.:|: ||..|.|..:
Mouse   185 ---------NVCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGG--CGSGLYPDAFAPVAEF 238

  Fly   252 RDWIRNVMSGNS 263
            .|||.:::..::
Mouse   239 ADWINSIIRSHN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 70/226 (31%)
Tryp_SPc 38..258 CDD:238113 72/228 (32%)
ElaneNP_056594.2 Tryp_SPc 28..242 CDD:214473 70/226 (31%)
Tryp_SPc 29..245 CDD:238113 72/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.