DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and cela1.2

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001011493.1 Gene:cela1.2 / 496993 XenbaseID:XB-GENE-5739190 Length:265 Species:Xenopus tropicalis


Alignment Length:270 Identity:86/270 - (31%)
Similarity:121/270 - (44%) Gaps:37/270 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVSITAIRIKGN-STDGRFYKD-QRIIGGQAAEDGFAPYQISLQGISGA---HSCGGAIINETFV 74
            |:.:.|..:.|. |.|.|..:| :|:|||...:....|:|:|||.:||.   |:|||::|....|
 Frog     4 LLVLAAFVLCGQCSNDIRLIEDHERVIGGTEVQRNSWPWQVSLQYLSGGSWYHTCGGSLIRANRV 68

  Fly    75 LTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHI--HCNY--DNPEMHNDIALLELVEPIA 135
            |||||||:.| :.:.|||...|.|...|...::....|  |.|:  :|.....||::|.|.....
 Frog    69 LTAAHCVDRA-VSYRVVVGDHNIYQNDGTEQYISVSRIVKHANWNPNNIAAGYDISILHLSSSAT 132

  Fly   136 WDERTQPIPLPLVPMQPGDEVIL--------TGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLS 192
            .:...:...|      |.|.|:|        ||||.|...|.....||...|..:.|..|.:...
 Frog   133 LNSYVKLAQL------PADNVVLAHNYNCVVTGWGKTSNNGNLASVLQQAPLPVIAHSTCSSGSY 191

  Fly   193 NDEDCDVGHICTFSRLGEG---ACHGDSGGPL---VSNGYLV-GLVNW--GWPCATGV-PDVHAS 247
            .........:|..   |:|   .|.|||||||   |:..|.| |:.::  ...|:|.: |.|...
 Frog   192 WGSTVKSTMVCAG---GDGVRSGCQGDSGGPLNCPVNGVYQVHGVTSFVSSSGCSTYLKPTVFTR 253

  Fly   248 VYFYRDWIRN 257
            |..|..||.|
 Frog   254 VSAYIGWINN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 76/242 (31%)
Tryp_SPc 38..258 CDD:238113 78/245 (32%)
cela1.2NP_001011493.1 Tryp_SPc 29..264 CDD:238113 78/245 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.