DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and XB5758585

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001011293.1 Gene:XB5758585 / 496746 XenbaseID:XB-GENE-5758586 Length:248 Species:Xenopus tropicalis


Alignment Length:241 Identity:67/241 - (27%)
Similarity:114/241 - (47%) Gaps:24/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DQRIIGGQAAEDGFAPYQISLQ---GISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTN 96
            |.:|||    |...||:....|   ...|...|||::|:..::::||.|  |....:|:...|.:
 Frog    19 DDKIIG----EYECAPHSQKWQVYFTYKGYPWCGGSLISSRWIISAASC--NQSPKYLIAHLGKH 77

  Fly    97 KYNQPGGRYFLKAIHI-------HCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGD 154
            ...:..|    ...||       |..|......|:|.|::|.||..:::..|||.:.....:.|.
 Frog    78 DITREEG----TEQHIQVEKTFPHNRYLGLSDSNNIMLVKLAEPAQFNQFVQPIKVASSCPREGK 138

  Fly   155 EVILTGWGSTVLWGTS-PIDLQVLYLQYVPHRECKALLSNDEDCDVGHICT-FSRLGEGACHGDS 217
            ...::|:|:...:... |..||.|.|..:|...|.|..| .:......:|. |::..:.:|.||:
 Frog   139 VCQVSGFGNLNSYAEKYPDRLQCLDLPILPESSCDAYFS-PKKMHTNLMCAGFAQDDKDSCQGDA 202

  Fly   218 GGPLVSNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVMSGN 262
            ||||:..|.|.|::.||..|: .|:|.|:..|..:.:|::|:::.|
 Frog   203 GGPLICKGELYGIILWGNECSGRGIPGVYLKVCNFTNWMQNIINNN 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 63/230 (27%)
Tryp_SPc 38..258 CDD:238113 64/232 (28%)
XB5758585NP_001011293.1 Tryp_SPc 21..240 CDD:214473 63/229 (28%)
Tryp_SPc 22..244 CDD:238113 64/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.