DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and ACR

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001088.2 Gene:ACR / 49 HGNCID:126 Length:421 Species:Homo sapiens


Alignment Length:305 Identity:92/305 - (30%)
Similarity:146/305 - (47%) Gaps:58/305 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNST-DG----RFYKDQ----RIIGGQAAEDGFAPYQISLQ 56
            :...:||:|     .||:.|   |.|:| ||    ||.::.    ||:||:||:.|..|:.:|||
Human     5 LPTAILLVL-----AVSVVA---KDNATCDGPCGLRFRQNPQGGVRIVGGKAAQHGAWPWMVSLQ 61

  Fly    57 ----GISGAHSCGGAIINETFVLTAAHCV--ENAFIPWLVV-----VT-GTNK-YNQPGGRYFLK 108
                .....|:|||:::|..:|||||||.  :|....|.:|     :| |.|| ...|....:::
Human    62 IFTYNSHRYHTCGGSLLNSRWVLTAAHCFVGKNNVHDWRLVFGAKEITYGNNKPVKAPLQERYVE 126

  Fly   109 AIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLP--LVPMQPGDEVI-LTGWG-------- 162
            .|.||..|::....|||||:|:..||:......|..||  ...:..|.:.. :.|||        
Human   127 KIIIHEKYNSATEGNDIALVEITPPISCGRFIGPGCLPHFKAGLPRGSQSCWVAGWGYIEEKAPR 191

  Fly   163 -STVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGE-GACHGDSGGPLV--- 222
             |::|. .:.:||..|.|       |.:....:......::|....:|: ..|.|||||||:   
Human   192 PSSILM-EARVDLIDLDL-------CNSTQWYNGRVQPTNVCAGYPVGKIDTCQGDSGGPLMCKD 248

  Fly   223 --SNGY-LVGLVNWGWPCATGV-PDVHASVYFYRDWIRNVMSGNS 263
              .:.| :||:.:||..||... |.::.:.:.|.:||.:.:..|:
Human   249 SKESAYVVVGITSWGVGCARAKRPGIYTATWPYLNWIASKIGSNA 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 76/250 (30%)
Tryp_SPc 38..258 CDD:238113 77/252 (31%)
ACRNP_001088.2 Tryp_SPc 42..285 CDD:214473 76/250 (30%)
Tryp_SPc 43..288 CDD:238113 77/252 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..316
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..383
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..421
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.